Analytical Data
-
Gene name
Cathepsin Z/CTSZ
-
简介
Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, C-His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuCathepsin X, His; Cathepsin Z; Cathepsin P; Cathepsin X; CTSZ
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9UBR2
-
Expression Region
G24-V303
-
AA Sequence
GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
37-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cathepsin Z (CTSZ) is a cysteine protease belonging to the cathepsin family, playing a crucial role in various biological processes, including protein degradation, immune response, and tissue remodeling. Its unique enzymatic activity and structural features have garnered significant research interest, particularly in the context of diseases such as cancer and neurodegeneration, where dysregulation of proteolytic activity is often observed. CTSZ has been implicated in the progression of several malignancies, and its expression levels are often altered in tumor tissues. As such, understanding the functional properties and regulation of CTSZ is essential for elucidating its role in pathophysiology and may offer insights for therapeutic interventions. The development of recombinant CTSZ protein allows for detailed biochemical studies, including enzyme kinetics, substrate specificity, and inhibitor screening. Additionally, such studies can enhance our comprehension of CTSZ's interactions with other proteins and its potential as a biomarker for disease progression. Ongoing research aims to determine the therapeutic potential of modulating CTSZ activity in various disease contexts, making it a promising target for future drug development.











