Recombinant Human Apolipoprotein E/APOE2 Protein (HEK293)，His

Apolipoprotein E/APOE2

Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is the recombinant human-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-6*His labeled tag and R154S, R176C mutation.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is ≤8.753 ng/mL. corresponding to a specific activity is ≥1.14×105 units/mg. Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 8.753 ng/mL.corresponding to a specific activity is 1.14×105units/mg.

Apo-E; AD2; Apoprotein; Alzheimer Disease 2(E4-Associated,Late Onset

Human

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

P02649

K19-H317, R154S, R176C

KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVSLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Full Length of Mature Protein

33-42 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.