Analytical Data
-
Gene name
Beta-lactamase CTX-M-1/Bla
-
简介
Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
bla; men1Beta-lactamase CTX-M-1; EC 3.5.2.6; Beta-lactamase MEN-1; Cefotaximase 1
-
Species
E.coli
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28585
-
Expression Region
Q29-L291
-
AA Sequence
QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
32.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Beta-lactamase CTX-M-1 is a pivotal enzyme responsible for the resistance of bacteria to beta-lactam antibiotics, including penicillins and cephalosporins. Its emergence is primarily linked to the spread of Extended-Spectrum Beta-Lactamases (ESBLs) in Enterobacteriaceae, which has led to increased treatment failures in infections caused by these pathogens. The CTX-M-1 gene is widely disseminated among various bacterial species, posing a significant public health threat. Research on the recombinant protein of CTX-M-1/Bla is crucial for understanding the mechanism of antibiotic resistance, as it can provide insights into enzyme structure-function relationships and the dynamics of resistance gene transfer. Furthermore, characterizing this recombinant protein can facilitate the development of novel inhibitors to combat beta-lactamase activity and enhance the efficacy of existing antibiotics. The recombinant production also allows for high-yield studies that can inform drug design and the implementation of alternative therapeutic strategies. Identifying the factors contributing to the spread and effectiveness of CTX-M-1 may prove instrumental in addressing the growing challenge of antibiotic resistance in clinical settings.











