Cat: IPD-X30810

Recombinant E.coli Beta-lactamase CTX-M-1/Bla Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Beta-lactamase CTX-M-1/Bla

  • 简介

    Beta-lactamase CTX-M-1/Bla protein is a broad-spectrum beta-lactamase that greatly contributes to antibiotic resistance by hydrolyzing penicillins and cephalosporins (including third-generation drugs). Beta-lactamase CTX-M-1/Bla Protein, E.coli (His) is the recombinant E. coli-derived Beta-lactamase CTX-M-1/Bla protein, expressed by E. coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    bla; men1Beta-lactamase CTX-M-1; EC 3.5.2.6; Beta-lactamase MEN-1; Cefotaximase 1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28585

  • Expression Region

    Q29-L291

  • AA Sequence

    QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    32.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Beta-lactamase CTX-M-1 is a pivotal enzyme responsible for the resistance of bacteria to beta-lactam antibiotics, including penicillins and cephalosporins. Its emergence is primarily linked to the spread of Extended-Spectrum Beta-Lactamases (ESBLs) in Enterobacteriaceae, which has led to increased treatment failures in infections caused by these pathogens. The CTX-M-1 gene is widely disseminated among various bacterial species, posing a significant public health threat. Research on the recombinant protein of CTX-M-1/Bla is crucial for understanding the mechanism of antibiotic resistance, as it can provide insights into enzyme structure-function relationships and the dynamics of resistance gene transfer. Furthermore, characterizing this recombinant protein can facilitate the development of novel inhibitors to combat beta-lactamase activity and enhance the efficacy of existing antibiotics. The recombinant production also allows for high-yield studies that can inform drug design and the implementation of alternative therapeutic strategies. Identifying the factors contributing to the spread and effectiveness of CTX-M-1 may prove instrumental in addressing the growing challenge of antibiotic resistance in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US