Analytical Data
-
Gene name
HMGB1/HMG-1
-
简介
The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuHigh mobility group protein B1/HMGB1, His; High Mobility Group Protein B1; High Mobility Group Protein 1; HMG-1; HMGB1; HMG1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P09429
-
Expression Region
G2-E215
-
AA Sequence
GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
-
Protein Length
Partial
-
Molecular Weight
25-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMGB1 (High Mobility Group Box 1) is a non-histone chromatin-binding protein that plays a critical role in various cellular processes, including DNA repair, gene expression regulation, and inflammation modulation. As a key player in the immune response, HMGB1 acts as a damage-associated molecular pattern (DAMP), signaling stress and tissue injury, and facilitating the activation of innate immunity. Elevated levels of HMGB1 have been linked to numerous pathological conditions, including autoimmune diseases, cancer, and sepsis, highlighting its potential as a therapeutic target. The recombinant form of HMGB1, often referred to as HMG-1, has been developed for extensive research into its biological functions and mechanisms. By producing HMG-1 through recombinant DNA technology, researchers can dissect its interactions with various cellular partners, elucidate its signaling pathways, and evaluate its therapeutic implications in controlling inflammation and promoting tissue repair. The use of recombinant HMGB1 has also enabled the exploration of its role in modulating immune responses, providing insights into its potential use as a biomarker for disease diagnosis and prognosis. Overall, the study of HMGB1/HMG-1 recombinant protein continues to be a fertile ground for understanding its multifaceted roles in health and disease, paving the way for innovative therapeutic approaches.











