Analytical Data
-
Gene name
IL-20R beta
-
简介
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.). IL-20R beta Protein, Cynomolgus (HEK293, His) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Alternative Names
Interleukin-20 receptor subunit beta; IL-20R-beta; IL-20RB; FNDC6; IL-20R2; DIRS1
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXL0
-
Expression Region
D30-A230
-
AA Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
-
Protein Length
Extracellular Domain
-
Molecular Weight
60-85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-20 receptor beta (IL-20Rβ) is a crucial component of the IL-20 receptor complex, which mediates the biological effects of IL-20 and IL-24, two cytokines involved in inflammatory and immune responses. Research into IL-20Rβ has gained interest due to its potential role in various dermatological and inflammatory diseases, such as psoriasis and atopic dermatitis, where these cytokines are known to be upregulated. Understanding the structure and function of IL-20Rβ can provide insights into its signaling pathways, which may lead to the development of targeted therapies aimed at modulating these inflammatory responses. Furthermore, recombinant IL-20Rβ protein studies can assist in elucidating the binding affinity and functional dynamics between the receptor and its ligands, thereby contributing to a deeper understanding of cytokine-receptor interactions. This, in turn, has implications for the design of novel therapeutic strategies that harness the modulation of the IL-20 signaling pathway in various disease contexts. The study of IL-20Rβ not only sheds light on fundamental immune mechanisms but also highlights its potential as a biomarker or therapeutic target, underscoring the significance of this research area in advancing our understanding of cytokine biology and its clinical applications.
