Analytical Data
-
Gene name
PDCD10
-
简介
The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Programmed Cell Death Protein 10; Cerebral Cavernous Malformations 3 Protein; TF-1 Cell Apoptosis-Related Protein 15; PDCD10; CCM3; TFAR15
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUL8
-
Expression Region
M1-Al212
-
AA Sequence
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
-
Protein Length
Full Length
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDCD10 (Programmed Cell Death Protein 10) is a protein that has garnered significant attention in recent years due to its involvement in various cellular processes, including apoptosis, angiogenesis, and cell proliferation. Research has indicated that PDCD10 plays a crucial role in the regulation of endothelial cell function and is implicated in the development of several diseases, including cancer and cardiovascular disorders. Functional studies have demonstrated that PDCD10 is essential for the survival of certain cell types and may act as a tumor suppressor by modulating cell death pathways. Its dysregulation has been associated with poor prognosis in various cancers, highlighting its potential as a therapeutic target. Additionally, the recombinant expression of PDCD10 protein is vital for elucidating its structural and functional properties, enabling researchers to explore its interactions with other proteins and cellular pathways in detail. Understanding the mechanisms by which PDCD10 influences cellular behavior could pave the way for novel therapeutic strategies aimed at diseases linked to its malfunction, making it an important area of study in molecular biology and medicine.











