Cat: IPD-X27616

Recombinant Human PDCD10 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDCD10

  • 简介

    The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Programmed Cell Death Protein 10; Cerebral Cavernous Malformations 3 Protein; TF-1 Cell Apoptosis-Related Protein 15; PDCD10; CCM3; TFAR15

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BUL8

  • Expression Region

    M1-Al212

  • AA Sequence

    MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

  • Protein Length

    Full Length

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDCD10 (Programmed Cell Death Protein 10) is a protein that has garnered significant attention in recent years due to its involvement in various cellular processes, including apoptosis, angiogenesis, and cell proliferation. Research has indicated that PDCD10 plays a crucial role in the regulation of endothelial cell function and is implicated in the development of several diseases, including cancer and cardiovascular disorders. Functional studies have demonstrated that PDCD10 is essential for the survival of certain cell types and may act as a tumor suppressor by modulating cell death pathways. Its dysregulation has been associated with poor prognosis in various cancers, highlighting its potential as a therapeutic target. Additionally, the recombinant expression of PDCD10 protein is vital for elucidating its structural and functional properties, enabling researchers to explore its interactions with other proteins and cellular pathways in detail. Understanding the mechanisms by which PDCD10 influences cellular behavior could pave the way for novel therapeutic strategies aimed at diseases linked to its malfunction, making it an important area of study in molecular biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US