Cat: IPD-X30993

Recombinant Human CELA3A Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CELA3A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuChymotrypsin-like elastase family member 3A/CELA3A, His; Chymotrypsin-Like Elastase Family Member 3A; Elastase IIIA; Elastase-3A; Protease E; CELA3A; ELA3; ELA3A

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09093

  • Expression Region

    S16-H270

  • AA Sequence

    SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    31.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CELA3A, also known as chymotrypsin-like elastase family member 3A, is a serine protease that plays a significant role in various physiological processes, including tissue remodeling and immune response. Research on CELA3A has garnered interest due to its potential implications in disease pathogenesis, particularly in inflammatory conditions and cancer. Elevated levels of CELA3A are often associated with chronic inflammatory diseases, such as asthma and chronic obstructive pulmonary disease (COPD), where it contributes to extracellular matrix degradation and tissue damage. Moreover, studies have suggested a role for CELA3A in tumor progression, as it may facilitate cancer cell invasion and metastasis by modulating the tumor microenvironment. Understanding the molecular mechanisms regulating CELA3A expression and activity is crucial for developing targeted therapeutics aimed at mitigating its pathological effects. Recent advancements in proteomic techniques and molecular biology have enabled researchers to elucidate the substrate specificity and functional pathways of CELA3A, highlighting its potential as a biomarker for disease diagnosis and a target for therapeutic intervention. Thus, ongoing research into CELA3A and its reconstituted protein forms aims to unravel its complex roles in health and disease, paving the way for novel treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US