Analytical Data
-
Gene name
CELA3A
- Application
-
Alternative Names
rHuChymotrypsin-like elastase family member 3A/CELA3A, His; Chymotrypsin-Like Elastase Family Member 3A; Elastase IIIA; Elastase-3A; Protease E; CELA3A; ELA3; ELA3A
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09093
-
Expression Region
S16-H270
-
AA Sequence
SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
31.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CELA3A, also known as chymotrypsin-like elastase family member 3A, is a serine protease that plays a significant role in various physiological processes, including tissue remodeling and immune response. Research on CELA3A has garnered interest due to its potential implications in disease pathogenesis, particularly in inflammatory conditions and cancer. Elevated levels of CELA3A are often associated with chronic inflammatory diseases, such as asthma and chronic obstructive pulmonary disease (COPD), where it contributes to extracellular matrix degradation and tissue damage. Moreover, studies have suggested a role for CELA3A in tumor progression, as it may facilitate cancer cell invasion and metastasis by modulating the tumor microenvironment. Understanding the molecular mechanisms regulating CELA3A expression and activity is crucial for developing targeted therapeutics aimed at mitigating its pathological effects. Recent advancements in proteomic techniques and molecular biology have enabled researchers to elucidate the substrate specificity and functional pathways of CELA3A, highlighting its potential as a biomarker for disease diagnosis and a target for therapeutic intervention. Thus, ongoing research into CELA3A and its reconstituted protein forms aims to unravel its complex roles in health and disease, paving the way for novel treatment strategies.











