Analytical Data
-
Gene name
Kallikrein-7
- Application
-
Alternative Names
rHuKallikrein 7/KLK7, His ; Kallikrein-7; hK7; Serine Protease 6; Stratum Corneum Chymotryptic Enzyme; hSCCE; KLK7; PRSS6; SCCE
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH32005
-
Expression Region
E23-H252
-
AA Sequence
EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH
-
Protein Length
Partial
-
Molecular Weight
28-32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Kallikrein-7 (KLK7) is a member of the kallikrein family of serine proteases, which play a crucial role in various physiological processes, including skin homeostasis, inflammation, and tissue remodeling. KLK7 is predominantly expressed in the skin and is implicated in the degradation of keratin, a key structural protein in the epidermis. Research has demonstrated that altered expression of KLK7 is associated with several dermatological conditions, including psoriasis, dermatitis, and skin cancer. The interest in KLK7 as a therapeutic target has grown, particularly due to its potential role in mediating inflammatory responses and promoting keratinocyte proliferation. Furthermore, KLK7 has been suggested as a biomarker for certain diseases, making it a focal point in diagnostic research. To investigate its functions and develop potential therapeutic applications, researchers have focused on producing recombinant KLK7 protein. This involves using modern biotechnological methods to express and purify KLK7 in vitro, allowing for in-depth studies of its enzymatic activity, regulation, and involvement in pathophysiological processes. Understanding KLK7's mechanisms could lead to innovative treatments for skin disorders and provide insights into other diseases linked to its dysregulation, highlighting its importance in both basic research and clinical applications.











