Cat: IPD-X31035

Recombinant Human PPP1CC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPP1CC

  • 简介

    PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit; PP-1G; Protein Phosphatase 1C Catalytic Subunit; PPP1CC

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His;C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P36873-1

  • Expression Region

    M1-K323

  • AA Sequence

    MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    30-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPP1CC, or Protein Phosphatase 1 Catalytic Subunit Gamma, plays a crucial role in various cellular processes by modulating protein phosphorylation states. It is a key component of the protein phosphatase 1 (PP1) family, involved in regulating cell signaling, metabolism, and cell cycle progression. Abnormalities in its expression or function have been linked to several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Research into PPP1CC has intensified due to its potential as a therapeutic target; understanding its structure and function can unveil new strategies for drug development. The reconstitution of PPP1CC as a recombinant protein has become an essential approach for studying its biochemical properties, interaction with regulatory subunits, and the impact of post-translational modifications. By utilizing advanced techniques such as crystallography and mass spectrometry, researchers aim to elucidate the precise mechanisms of PPP1CC in cellular signaling pathways. Furthermore, investigating how PPP1CC interacts with other proteins could provide insights into its role in disease progression, making it a critical focus of molecular and cellular biology research. As a result, the study of PPP1CC not only enhances our understanding of fundamental biological processes but also paves the way for innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US