Cat: IPD-X27719

Recombinant Others Pollen allergen Phl p 5b Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Pollen allergen Phl p 5b

  • 简介

    Pollen allergen Phl p 5b protein, with ribonuclease activity, is speculated to participate in host-pathogen interactions. Its structural configuration involves a homodimer linked by disulfide bonds, highlighting its molecular arrangement in cellular processes. Pollen allergen Phl p 5b Protein, Phleum pratense (His-SUMO) is the recombinant Pollen allergen Phl p 5b protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Pollen allergen Phl p 5b; Allergen Phl p Vb; allergen Phl p 5b; Fragment

  • Species

    Others

  • Source

    E. coli

  • Tag

    N-His;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q40963

  • Expression Region

    A20-V284

  • AA Sequence

    ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Pollen allergen Phl p 5b, a significant allergen derived from Timothy grass (Phleum pratense), has garnered substantial attention in the field of allergy research due to its role in inducing allergic responses in sensitized individuals. Grass pollen allergy is a prevalent condition that affects millions, leading to symptoms such as rhinitis, asthma, and overall diminished quality of life during peak pollen seasons. The Phl p 5b protein is part of a group of non-specific lipid transfer proteins (nsLTPs) known for their capacity to trigger IgE-mediated allergic reactions. Understanding the structure and function of Phl p 5b is crucial for developing effective diagnostic and therapeutic strategies, including allergen immunotherapy. Recent advancements in recombinant DNA technology have facilitated the production of this allergen in a lab setting, allowing researchers to study its properties without the variability associated with natural sources. This recombinant protein serves as a valuable tool for investigating allergenicity, assessing immune responses, and screening potential treatments. Characterizing Phl p 5b at the molecular level also contributes to the overall understanding of cross-reactivity among various pollen allergens, aiding in the development of more targeted and personalized therapeutic approaches for those affected by grass pollen allergies. The ongoing research into recombinant Phl p 5b not only holds promise for improved allergy management but also enhances our knowledge of allergic mechanisms, ultimately contributing to the broader field of immunology and allergy treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US