Analytical Data
-
Gene name
PTPRZ1
-
简介
The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.
- Application
-
Alternative Names
3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; PTPRZ
-
Species
Human
-
Source
P. pastoris
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23471-1
-
Expression Region
I36-Y300
-
AA Sequence
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
-
Protein Length
Partial
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPRZ1, or protein tyrosine phosphatase receptor type Z1, is an important receptor protein that plays a critical role in various biological processes, including cell signaling, neural development, and the regulation of cell adhesion and migration. Dysregulation of PTPRZ1 has been implicated in numerous pathological conditions, including cancers and neurological disorders. The study of PTPRZ1 recombinant proteins has gained momentum in recent years due to the protein's potential as a therapeutic target and its relevance to disease mechanisms. Advances in molecular biology techniques have enabled the production of recombinant PTPRZ1, allowing researchers to investigate its structure-function relationships, ligand interactions, and regulatory pathways. Through the use of recombinant proteins, researchers can better understand PTPRZ1's role in cellular processes and its implications in disease scenarios, paving the way for the development of targeted therapies. Additionally, the exploration of PTPRZ1’s interactions with other signaling molecules and its impact on cell behavior further highlights its significance in both normal physiology and disease pathology. As a result, PTPRZ1 has emerged as a focal point in biomedical research, with ongoing studies aimed at elucidating its full biological potential and therapeutic applications.
