Analytical Data
-
Gene name
Kallikrein-8
-
简介
Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Application
-
Alternative Names
Klk8; Nrpn; Prss19Kallikrein-8; mK8; EC 3.4.21.118; Neuropsin; NP; Serine protease 19
-
Species
Mouse
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q61955
-
Expression Region
I33-D260
-
AA Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
32 kDa. The reducing (R) protein migrates as 32 kDa in SDS-PAGE due to glycosylation.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Kallikrein-8 (KLK8), a member of the kallikrein family of serine proteases, has garnered significant attention due to its potential roles in various biological processes and diseases. Initially identified in the brain, KLK8 is involved in neurodevelopment and is implicated in the modulation of neurogenic and inflammatory pathways. Its dysregulation has been linked to neurological disorders, including Alzheimer's disease, where KLK8 may influence amyloid precursor protein processing and tau pathology. Furthermore, KLK8 has been suggested as a biomarker for certain malignancies, notably in breast cancer, where its expression levels may correlate with tumor aggressiveness and patient prognosis. The recombinant production of KLK8 allows for detailed biochemical characterization, functional assays, and investigations into its substrate specificity, thereby elucidating its physiological functions and potential therapeutic applications. Advances in recombinant DNA technology have facilitated the expression and purification of KLK8, enabling researchers to study its enzymatic properties and interactions within various biological contexts. Understanding KLK8's mechanisms of action could pave the way for novel diagnostic and therapeutic strategies targeting a range of diseases associated with its aberrant activity, underscoring the importance of this protease in both basic science and clinical applications.











