Cat: IPD-X31120

Recombinant Mouse Kallikrein-8 Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-8

  • 简介

    Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Klk8; Nrpn; Prss19Kallikrein-8; mK8; EC 3.4.21.118; Neuropsin; NP; Serine protease 19

  • Species

    Mouse

  • Source

    P. pastoris

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q61955

  • Expression Region

    I33-D260

  • AA Sequence

    ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    32 kDa. The reducing (R) protein migrates as 32 kDa in SDS-PAGE due to glycosylation.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-8 (KLK8), a member of the kallikrein family of serine proteases, has garnered significant attention due to its potential roles in various biological processes and diseases. Initially identified in the brain, KLK8 is involved in neurodevelopment and is implicated in the modulation of neurogenic and inflammatory pathways. Its dysregulation has been linked to neurological disorders, including Alzheimer's disease, where KLK8 may influence amyloid precursor protein processing and tau pathology. Furthermore, KLK8 has been suggested as a biomarker for certain malignancies, notably in breast cancer, where its expression levels may correlate with tumor aggressiveness and patient prognosis. The recombinant production of KLK8 allows for detailed biochemical characterization, functional assays, and investigations into its substrate specificity, thereby elucidating its physiological functions and potential therapeutic applications. Advances in recombinant DNA technology have facilitated the expression and purification of KLK8, enabling researchers to study its enzymatic properties and interactions within various biological contexts. Understanding KLK8's mechanisms of action could pave the way for novel diagnostic and therapeutic strategies targeting a range of diseases associated with its aberrant activity, underscoring the importance of this protease in both basic science and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US