Analytical Data
-
Gene name
FAM167A
-
简介
FAM167A protein shows significant expression in multiple tissues, including skin, spleen, kidney, leukocytes, testis, lung, small intestine, and prostate. This diverse expression pattern suggests potential roles in various physiological processes across organs and cell types. FAM167A Protein, Human (HEK293, Myc, His) is the recombinant human-derived FAM167A protein, expressed by HEK293 , with N-His, C-Myc labeled tag.
- Application
-
Alternative Names
FAM167A; C8orf13Protein FAM167A
-
Species
Human
-
Source
HEK293
-
Tag
N-His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KS9
-
Expression Region
M1-C214
-
AA Sequence
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM167A, also known as the "Family with Sequence Similarity 167A," is a protein that has garnered significant interest in molecular biology and immunology due to its potential role in various biological processes and diseases. Research into FAM167A began with its identification in the context of autoimmune disorders and cancer, where it appears to be involved in immune regulation and cellular signaling pathways. The protein is thought to influence the activity of immune cells, potentially affecting their proliferation and differentiation. Its unique structure and sequence similarities to other proteins in the family suggest a functional role in mediating interactions between cells and their environment. Additionally, studies have shown that altered expression of FAM167A may correlate with disease states, highlighting its significance as a potential biomarker or therapeutic target. The recombinant expression of FAM167A enables researchers to study its functional properties in detail, providing insights into its mechanisms of action and interactions with other cellular components. As a result, the exploration of FAM167A not only contributes to our understanding of the immune system but also holds promise for the development of innovative strategies for disease intervention, making it a focal point of ongoing research in the fields of biochemistry and immunotherapy.
