Analytical Data
-
Gene name
LolA
-
简介
LolA Protein translocates lipoproteins from bacterial inner to outer membranes, forming a complex dependent on the absence of aspartate after the N-terminal cysteine. Aspartate signals lipoproteins to stay in the inner membrane. LolA, as a monomer, efficiently moves lipoproteins between bacterial membrane compartments. LolA Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived LolA protein, expressed by P. pastoris , with N-His labeled tag.
- Application
-
Alternative Names
lolA; Outer-membrane lipoprotein carrier protein
-
Species
E.coli
-
Source
P. pastoris
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A7ZYJ5
-
Expression Region
D22-K203
-
AA Sequence
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LolA, or Lipoprotein Release Factor A, is a crucial protein involved in the transport and assembly of lipoproteins in bacterial membranes, particularly in Gram-negative bacteria. The study of LolA has gained interest due to its role in bacterial pathogenesis and membrane integrity, which are vital for bacterial survival and virulence. Research indicates that LolA is responsible for the efficient delivery of lipoproteins to the outer membrane, a process that is essential for maintaining cellular function and structure. Understanding LolA's mechanisms can provide insights into bacterial physiology and potential therapeutic targets. The significance of LolA is underscored by its involvement in antibiotic resistance, as disruptions in lipoprotein trafficking can affect bacterial susceptibility to certain antibiotics. Additionally, the potential to exploit LolA's pathways for drug delivery systems or vaccine development presents a promising avenue for further research. Overall, the investigation of LolA and its functional characteristics not only contributes to our knowledge of bacterial biology but also holds the potential for novel approaches in combating bacterial infections.
