Cat: IPD-X12838

Recombinant Mouse ANGPTL3/Angiopoietin-like 3 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPTL3/Angiopoietin-like 3

  • 简介

    ANGPTL3/Angiopoietin-like 3 Protein, Mouse (HEK293, His) is a mouse recombinant ANGPTL3 with a 10-His tag at the C-terminus. Angiopoietin-like Protein 3, Mouse (HEK293, His) is produced by Mammalian expression system and the target gene encoding Ser17-Thr455 is expressed.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuAngiopoietin-like Protein 3, His; ANGPTL3; Angiopoietin-like Protein 3

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9R182

  • Expression Region

    S17-T206

  • AA Sequence

    SRVDPDLSSFDSAPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKELRRTTSTLQVKNEEVKNMSVELNSKLESLLEEKTALQHKVRALEEQLTNLILSPAGAQEHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHMQIKEIEKQLRKTHHHHHH

  • Protein Length

    Partial

  • Molecular Weight

    25-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPTL3, or Angiopoietin-like 3, is a protein that plays a significant role in lipid metabolism and cardiovascular health. It is primarily produced by the liver and is implicated in regulating triglyceride levels in the bloodstream. Research has shown that ANGPTL3 functions as an inhibitor of lipoprotein lipase (LPL), an enzyme vital for the hydrolysis of triglycerides in lipoproteins, thereby influencing overall lipid profiles. Dysregulation of ANGPTL3 has been linked to various metabolic disorders, including dyslipidemia and atherosclerosis, making it a potential therapeutic target for cardiovascular disease. Recent studies have focused on the development of recombinant ANGPTL3 proteins to investigate their structural properties and functional roles in lipid metabolism. These recombinant proteins are essential for elucidating the mechanisms by which ANGPTL3 affects triglyceride levels and for screening potential pharmacological agents that can modulate its activity. Understanding the function of ANGPTL3 and its influence on lipid metabolism could lead to innovative treatments for diseases associated with lipid dysregulation, positioning it as a promising area of research in metabolic health and cardiovascular risk management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US