Cat: IPD-X12855

Recombinant Human ANGPTL4/Angiopoietin-related 4 Protein, N-GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPTL4/Angiopoietin-related 4

  • 简介

    ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli , with N-GST labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein ; HFARP

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BY76-1

  • Expression Region

    V28-E403

  • AA Sequence

    VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE

  • Protein Length

    Partial

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPTL4, or Angiopoietin-like 4, is a protein that plays a critical role in regulating lipid metabolism, inflammation, and angiogenesis. Discovered as a key factor in metabolic disorders, ANGPTL4 is primarily produced in various tissues, including adipose tissue, liver, and muscles. Its unique ability to inhibit lipoprotein lipase (LPL) leads to increased plasma triglyceride levels, linking it to obesity, diabetes, and cardiovascular diseases. Furthermore, ANGPTL4 has been implicated in tumor biology, where it can either inhibit or promote cancer progression depending on the context. Research into ANGPTL4 has gained momentum due to its potential as a biomarker for metabolic disorders and as a therapeutic target. Recombinant ANGPTL4 proteins are being explored for their functional roles in these pathways, providing insights into their biology and potential applications in treatment. Understanding the mechanisms behind ANGPTL4's diverse functions could pave the way for innovative strategies in managing metabolic diseases and cancer therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US