Analytical Data
-
Gene name
ANGPTL4/Angiopoietin-related 4
-
简介
ANGPTL4 protein mediates lipoprotein lipase (LPL) inactivation, regulating triglyceride clearance and lipid metabolism. It also affects glucose homeostasis, insulin sensitivity, endothelial cell function, and angiogenesis. Cleaved ANGPTL4 is more active in LPL inactivation, highlighting its multifaceted role in metabolic and vascular regulation. ANGPTL4/Angiopoietin-related 4 Protein, Human (GST) is the recombinant human-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Angiopoietin-like protein 4Hepatic fibrinogen/angiopoietin-related protein ; HFARP
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BY76-1
-
Expression Region
V28-E403
-
AA Sequence
VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGPTL4, or Angiopoietin-like 4, is a protein that plays a critical role in regulating lipid metabolism, inflammation, and angiogenesis. Discovered as a key factor in metabolic disorders, ANGPTL4 is primarily produced in various tissues, including adipose tissue, liver, and muscles. Its unique ability to inhibit lipoprotein lipase (LPL) leads to increased plasma triglyceride levels, linking it to obesity, diabetes, and cardiovascular diseases. Furthermore, ANGPTL4 has been implicated in tumor biology, where it can either inhibit or promote cancer progression depending on the context. Research into ANGPTL4 has gained momentum due to its potential as a biomarker for metabolic disorders and as a therapeutic target. Recombinant ANGPTL4 proteins are being explored for their functional roles in these pathways, providing insights into their biology and potential applications in treatment. Understanding the mechanisms behind ANGPTL4's diverse functions could pave the way for innovative strategies in managing metabolic diseases and cancer therapies.











