Cat: IPD-X31404

Recombinant Human PLBD2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLBD2

  • 简介

    The PLBD2 protein is a putative phospholipase that interacts with IGF2R, suggesting a potential role in insulin-like growth factor 2 receptor-related signaling pathways. Although the enzymatic activity and functional role of PLBD2 remain to be characterized in detail, its association with IGF2R suggests involvement in cell signaling related to growth and development. PLBD2 Protein, Human (HEK293, His) is the recombinant human-derived PLBD2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Putative phospholipase B-like 2; p76; LAMA-like protein 2; PLBD2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q8NHP8-1

  • Expression Region

    I42-D589

  • AA Sequence

    IPAPGGRWARDGQVPPASRSRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    80 & 45 & 32 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLBD2 (phospholipase B domain-containing protein 2) has emerged as a protein of interest due to its potential roles in lipid metabolism and cellular signaling. This protein is primarily expressed in various tissues, suggesting its involvement in diverse biological processes. Research indicates that PLBD2 might contribute to membrane lipid remodeling and thus influence cell membrane properties, impacting cellular functions such as growth, differentiation, and apoptosis. Given its enzymatic activity related to phospholipid hydrolysis, PLBD2 has been implicated in the pathogenesis of several diseases, including inflammatory disorders and metabolic syndromes. Despite its potential significance, the detailed mechanisms through which PLBD2 operates remain poorly understood, necessitating further investigation. Recombinant PLBD2 protein studies provide a valuable tool for elucidating its structural and functional characteristics, enabling researchers to explore its enzymatic properties, substrate specificity, and regulatory mechanisms. Such studies could open novel therapeutic avenues targeting PLBD2-related pathways, making it a focal point for future research in both basic biology and clinical applications. Overall, by advancing our understanding of PLBD2, we aim to clarify its biological significance and therapeutic potential in various health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US