Analytical Data
-
Gene name
Biglycan
-
简介
Biglycan Protein, Human (HEK293, His) is a recombinant human Biglycan produced in HEK293 cells with a His tag. Biglycan, a small leucine-rich proteoglycan, acts as a danger signal and is classically thought to promote macrophage recruitment via Toll-like receptors (TLR) 2 and 4[1].
- Application
-
Biological Activity
1. Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED50 this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg. 2. Measured by its ability to inhibit the cell growth of 3T3‑L1 cells. The ED50 for this effect is 5.9 μg/mL, corresponding to a specific activity is 169 units/mg. Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED50 for this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg.
-
Alternative Names
rHuBiglycan, His; Biglycan; BGN; SLRR1A
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P21810
-
Expression Region
E20-K368
-
AA Sequence
EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
40-90 kDa,.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Biglycan is a small leucine-rich proteoglycan that plays a crucial role in the regulation of collagen fibril formation and the maintenance of extracellular matrix integrity. As a member of the small leucine-rich proteoglycan family, it is primarily found in connective tissues and has been implicated in various biological processes, including wound healing, inflammation, and tumor progression. Research on recombinant biglycan protein has gained significance due to its potential therapeutic applications in regenerative medicine and tissue engineering. By studying recombinant biglycan, scientists aim to elucidate its structural properties and functional roles in the extracellular matrix, which may pave the way for developing novel biomaterials that enhance tissue regeneration. Additionally, understanding the molecular mechanisms by which biglycan interacts with other extracellular matrix components can provide insights into the pathophysiology of various diseases, including osteoarthritis and cancer. As such, the development of recombinant biglycan not only offers opportunities for advanced biomaterial design but also opens up new avenues for targeted therapies that exploit its unique properties in modulating cellular behavior and tissue repair.











