Analytical Data
-
Gene name
IL-21R
-
简介
The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL.
-
Alternative Names
Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
Q9JHX3
-
Expression Region
C20-P236
-
AA Sequence
CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
-
Protein Length
Extracellular Domain
-
Molecular Weight
63-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-21 receptor (IL-21R) is a crucial component of the immune system, playing a significant role in regulating the differentiation and activity of various immune cells, including T and B lymphocytes. Understanding the function of IL-21R is essential for elucidating its involvement in immune responses, particularly in the context of autoimmune diseases, infections, and cancer. The recombinant IL-21R protein has emerged as a valuable tool for research, enabling scientists to investigate its signaling pathways, receptor interactions, and biological effects. By producing and purifying IL-21R as a recombinant protein, researchers can conduct in vitro studies to further dissect the mechanisms by which IL-21R influences immune cell behavior and how its dysregulation may lead to pathological conditions. Furthermore, recombinant IL-21R can serve as a potential therapeutic target, paving the way for innovative treatment strategies aimed at modulating immune responses in various diseases. Overall, the research on IL-21R recombinant protein contributes to a deeper understanding of immune modulation and holds promise for advancing immunotherapy and targeted therapies.








