Cat: IPD-X10526

Recombinant Mouse IL-21R Protein (HEK293), C-hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-21R

  • 简介

    The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL.

  • Alternative Names

    Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    Q9JHX3

  • Expression Region

    C20-P236

  • AA Sequence

    CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    63-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-21 receptor (IL-21R) is a crucial component of the immune system, playing a significant role in regulating the differentiation and activity of various immune cells, including T and B lymphocytes. Understanding the function of IL-21R is essential for elucidating its involvement in immune responses, particularly in the context of autoimmune diseases, infections, and cancer. The recombinant IL-21R protein has emerged as a valuable tool for research, enabling scientists to investigate its signaling pathways, receptor interactions, and biological effects. By producing and purifying IL-21R as a recombinant protein, researchers can conduct in vitro studies to further dissect the mechanisms by which IL-21R influences immune cell behavior and how its dysregulation may lead to pathological conditions. Furthermore, recombinant IL-21R can serve as a potential therapeutic target, paving the way for innovative treatment strategies aimed at modulating immune responses in various diseases. Overall, the research on IL-21R recombinant protein contributes to a deeper understanding of immune modulation and holds promise for advancing immunotherapy and targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US