Analytical Data
-
Gene name
CRISP-3
-
简介
The CRISP-3 protein interacts with A1BG, indicating a molecular association with potential functional implications. This suggests that CRISP-3 may be involved in processes associated with or regulated by A1BG. The specific nature and significance of this interaction require further elucidation, emphasizing the need for additional investigation into the molecular mechanisms and biological consequences of the CRISP-3 and A1BG interaction. CRISP-3 Protein, Human (HEK293, His) is the recombinant human-derived CRISP-3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuCysteine-rich secretory protein 3/CRISP-3, His; Cysteine-Rich Secretory Protein 3; CRISP-3; Specific Granule Protein of 28 kDa; SGP28; CRISP3
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54108
-
Expression Region
N21-Y245
-
AA Sequence
NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
25-32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRISP-3, a member of the cysteine-rich secretory protein (CRISP) family, has garnered attention in the field of immunology and reproductive biology due to its distinct structural characteristics and functional roles. Originally identified in the context of the male reproductive system, CRISP-3 is believed to play a crucial role in sperm maturation and fertilization processes. The protein is secreted by the epithelial cells of the male genital tract and exhibits properties such as immunomodulation and potential involvement in cellular signaling pathways. Research has suggested that CRISP-3 may influence immune responses by modulating the activity of various immune cells, making it a candidate for exploring its therapeutic potential in conditions involving immune disorders or reproductive challenges. Additionally, understanding the mechanisms underlying CRISP-3 function could provide insights into male fertility and lead to the development of novel contraceptive methods or treatments for infertility. Given the growing interest in reproductive health, further studies are warranted to elucidate the molecular pathways associated with CRISP-3 and its implications for human health and disease.










