Analytical Data
-
Gene name
IL-1R1
-
简介
IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM)[1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Human (HEK293, His) is a recombinant human extracellular region of IL-1R1 (L18-T332) with a C-Terminal 6*His tag, which is produced in HEK293 cells.
- Application
-
Biological Activity
Measured by its ability to inhibit IL-1 beta -dependent proliferation in CTLL-2 cells. Under the action of 30 pg/mL recombinant human IL-1β. The ED50 for this effect is 1.286 μg/mL, corresponding to a specific activity is 7.776×10^2 units/mg. Measured by its ability to inhibit IL-1 beta -dependent proliferation in CTLL-2 cells. Under the action of 30 pg/mL recombinant human IL-1β, The ED50 for this effect is 1.286 μg/mL, corresponding to a specific activity is 7.776×102 units/mg.
-
Alternative Names
Interleukin-1 receptor type 1; IL-1R-1; IL-1RT-1; Interleukin-1 receptor alpha; IL-1R-alpha; p80; CD121a
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P14778
-
Expression Region
L18-T332
-
AA Sequence
LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
-
Protein Length
Extracellular Domain
-
Molecular Weight
45-62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-1 receptor type 1 (IL-1R1) is a key component of the interleukin-1 (IL-1) signaling pathway, which plays a crucial role in mediating inflammatory responses and immune regulation. This receptor is primarily engaged by two pro-inflammatory cytokines, IL-1α and IL-1β, which are implicated in various inflammatory diseases, including rheumatoid arthritis, sepsis, and other autoimmune disorders. Due to its pivotal role in inflammation and immune response, IL-1R1 has become a target for therapeutic intervention. Recombinant IL-1R1 protein is utilized in research to better understand its structure, function, and the downstream signaling pathways it activates. Purifying and studying IL-1R1 allows researchers to explore its role in health and disease, assess potential therapeutic strategies, and develop new treatments targeting the IL-1 pathway. Moreover, insights gained from IL-1R1 studies could lead to novel biomarker identification and aid in the discovery of drugs that can modulate IL-1-related signaling, thus offering avenues for the treatment of chronic inflammatory conditions. Understanding the dynamics of IL-1R1 interactions and its signaling mechanisms remains a significant focus in immunology and therapeutic research, underscoring the importance of this receptor in maintaining immune homeostasis and its potential as a therapeutic target in various disease contexts.











