Analytical Data
-
Gene name
IL-6R
-
简介
IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Rhesus Macaque consists of 365 amino acids (M1-P365) and is produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human rhesus IL-6R is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL6 . The ED50 for this effect is 73.24 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human rhesus IL6R is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human IL-6 . The ED50 for this effect is 73.24 ng/mL.
-
Alternative Names
Interleukin-6 receptor subunit alpha; IL-6R-alpha; IL-6R 1; gp80; CD126
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
XP_001114404.1
-
Expression Region
L20-P365
-
AA Sequence
LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP
-
Protein Length
Partial
-
Molecular Weight
60-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-6 receptor (IL-6R) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in various physiological and pathological processes, including immune response, inflammation, and hematopoiesis. The dysregulation of IL-6R and its downstream signaling has been implicated in numerous diseases, such as rheumatoid arthritis, cancer, and cardiovascular disorders. As a result, the development of recombinant IL-6R proteins has garnered substantial interest in the biomedical field. These recombinant proteins can be utilized as therapeutic agents or as research tools to better understand the IL-6 signaling axis. For instance, soluble forms of IL-6R can act as decoy receptors that bind IL-6, thereby inhibiting its activity and modulating inflammatory responses. Furthermore, the study of IL-6R variants and their interactions with different ligands can provide insights into the receptor's role in disease mechanisms and potential therapeutic targets. Overall, the research into IL-6R recombinant proteins not only expands our understanding of IL-6 biology but also opens avenues for innovative treatment strategies for diseases associated with aberrant IL-6 signaling.
