Analytical Data
-
Gene name
Chymase/CMA1
-
简介
Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion.Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E.coli , with N-His labeled tag.
- Application
-
Alternative Names
Alpha-chymase; Mast cell chymase 1; Mast cell protease 5; mMCP-5; Mast cell protease I
-
Species
Mouse
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21844
-
Expression Region
I22-E246
-
AA Sequence
IGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
29.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Chymase, also known as CMA1 (Chymase 1), is a serine protease primarily expressed in mast cells and plays a crucial role in various physiological and pathological processes, including inflammation, tissue remodeling, and cardiovascular diseases. Its ability to cleave a wide range of substrates, such as peptide hormones, extracellular matrix proteins, and cytokines, underscores its significance in modulating immune responses and contributing to tissue homeostasis. Research on Chymase/CMA1 has gained traction due to its potential implications in several diseases, including asthma, atherosclerosis, and other allergic inflammatory conditions. Furthermore, the therapeutic targeting of Chymase has been explored as a promising strategy for managing these conditions. The development of recombinant Chymase/CMA1 proteins serves as a pivotal tool for understanding their biological functions and investigating their roles in disease mechanisms. These recombinant proteins facilitate enhanced studies in enzymatic activity, substrate specificity, and interaction with inhibitors, providing insights into their therapeutic potentials. Recent advances in recombinant DNA technology enable the production of high-yield, active Chymase proteins, paving the way for detailed structural and functional analyses. Consequently, the ongoing research aims to elucidate the multifaceted roles of Chymase/CMA1 in health and disease, ultimately striving to harness these insights for the development of novel therapeutic approaches targeting mast cell-derived chymase, which may offer new avenues for treating a variety of mast cell-related disorders.











