Cat: IPD-X28275

Recombinant Others NAD2 Protein (E. coli Cell-free),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NAD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NADH dehydrogenase subunit 2; nad2

  • Species

    Others

  • Source

    E. coli Cell-free

  • Tag

    N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A075XDS2

  • Expression Region

    G32-L300

  • AA Sequence

    GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NAD2, or Nicotinamide Adenine Dinucleotide II, is a crucial component of the mitochondrial respiratory chain, playing a significant role in cellular energy metabolism. Research on NAD2 recombinant proteins has gained momentum due to their potential applications in understanding mitochondrial function and related diseases. Mitochondrial dysfunction is linked to various pathologies, including neurodegenerative disorders, metabolic syndromes, and aging. The study of NAD2 not only aids in elucidating the biochemical pathways involved in energy production but also provides insights into the regulatory mechanisms of oxidative phosphorylation. Recombinant NAD2 proteins enable researchers to investigate the protein's structure-function relationship and interactions with other mitochondrial components in vitro. By employing molecular biology techniques, scientists can produce these proteins in sufficient quantities for detailed functional assays and structural studies, thereby facilitating drug discovery and therapeutic intervention strategies for mitochondrial disorders. Consequently, the ongoing research into NAD2 recombinant proteins is vital for advancing our understanding of mitochondrial dynamics and developing innovative treatments for related health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US