Cat: IPD-X31712

Recombinant Human PTPRG Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTPRG

  • 简介

    PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTPRG; Receptor-type tyrosine-protein phosphatase gamma; Protein-tyrosine phosphatase gamma; R-PTP-gamma

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23470

  • Expression Region

    P820-N1130

  • AA Sequence

    PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN

  • Protein Length

    Partial

  • Molecular Weight

    36 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTPRG, or protein tyrosine phosphatase receptor-type G, is a member of the protein tyrosine phosphatase family, which plays a crucial role in regulating various cellular processes, including cell growth, differentiation, and signal transduction. Recent studies have highlighted the significance of PTPRG in tumorigenesis and its potential as a tumor suppressor, particularly in various cancers such as colorectal and breast cancer. Its expression is often downregulated in malignant tissues, suggesting a protective role against cancer progression. Research on PTPRG has expanded towards the exploration of its mechanisms of action, particularly through the study of its extracellular domain and potential ligands, which may provide insights into its role in cell signaling pathways. As a receptor-type phosphatase, PTPRG is known to interact with multiple signaling molecules, potentially affecting pathways like PI3K/Akt and Ras/MAPK. The generation of recombinant PTPRG proteins has been pivotal in these studies, allowing for detailed biochemical analyses and the examination of its phosphatase activity. Understanding the structure-function relationship of PTPRG through recombinant protein studies could pave the way for the development of novel therapeutic interventions targeting its pathway, offering hope for new cancer treatments. Overall, the research on PTPRG and its recombinant proteins serves to elucidate the complex biology of this phosphatase, contributing to the broader understanding of tumor biology and therapeutic strategies in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US