Analytical Data
-
Gene name
PTPRG
-
简介
PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
PTPRG; Receptor-type tyrosine-protein phosphatase gamma; Protein-tyrosine phosphatase gamma; R-PTP-gamma
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23470
-
Expression Region
P820-N1130
-
AA Sequence
PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN
-
Protein Length
Partial
-
Molecular Weight
36 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPRG, or protein tyrosine phosphatase receptor-type G, is a member of the protein tyrosine phosphatase family, which plays a crucial role in regulating various cellular processes, including cell growth, differentiation, and signal transduction. Recent studies have highlighted the significance of PTPRG in tumorigenesis and its potential as a tumor suppressor, particularly in various cancers such as colorectal and breast cancer. Its expression is often downregulated in malignant tissues, suggesting a protective role against cancer progression. Research on PTPRG has expanded towards the exploration of its mechanisms of action, particularly through the study of its extracellular domain and potential ligands, which may provide insights into its role in cell signaling pathways. As a receptor-type phosphatase, PTPRG is known to interact with multiple signaling molecules, potentially affecting pathways like PI3K/Akt and Ras/MAPK. The generation of recombinant PTPRG proteins has been pivotal in these studies, allowing for detailed biochemical analyses and the examination of its phosphatase activity. Understanding the structure-function relationship of PTPRG through recombinant protein studies could pave the way for the development of novel therapeutic interventions targeting its pathway, offering hope for new cancer treatments. Overall, the research on PTPRG and its recombinant proteins serves to elucidate the complex biology of this phosphatase, contributing to the broader understanding of tumor biology and therapeutic strategies in oncology.











