Cat: IPD-X31728

Recombinant Human USP8 Protein (Baculovirus)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    USP8

  • 简介

    USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    The fundamental role of USP8 is specific removal of ubiquitin from substrates. USP8 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535nM emission light under the excitation condition of 485nM. The signal of which can be quickly and reliably captured using a microplate reader. The concentration of USP8 used is 0.6 nM, and the reaction lasts for 30 minutes. Under these conditions, the signal-to-noise ratio (S/N) of the signal box is greater than or equal to 10.

  • Alternative Names

    Ubiquitin carboxyl-terminal hydrolase 8; Deubiquitinating enzyme 8; Ubiquitin isopeptidase Y (hUBPy); Ubiquitin thioesterase 8; Ubiquitin-specific-processing protease 8; KIAA0055; UBPY

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P40818-1

  • Expression Region

    P734-G1110

  • AA Sequence

    PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG

  • Protein Length

    Partial

  • Molecular Weight

    43.5 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

USP8 (Ubiquitin-Specific Protease 8) is an important deubiquitinating enzyme that plays a pivotal role in the regulation of various cellular processes by removing ubiquitin moieties from target proteins, thus controlling their stability and activity. Dysregulation of USP8 has been linked to various diseases, including cancers and neurodegenerative disorders. As a result, understanding its structure and function is crucial for elucidating its biological roles and potential as a therapeutic target. Recent research has revealed that USP8 is involved in key signaling pathways, including those governing cell cycle progression and apoptosis, while mutations in the USP8 gene have been associated with Cushing's disease, a condition characterized by excessive cortisol production. The expression and activity of USP8 can be influenced by various factors, including post-translational modifications and protein-protein interactions, making it a complex but fascinating subject of study. The recombination and purification of USP8 protein for functional assays and structural studies are essential for advancing our knowledge of its mechanisms. Investigating the enzymatic activity of USP8 and its impact on substrate proteins can provide insights into how its dysregulation contributes to disease pathogenesis and may guide the development of novel therapeutic strategies. In light of its significance, ongoing research aims to elucidate the molecular mechanisms underlying USP8's functions, offering the potential for innovative approaches to modulate its activity in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US