Cat: IPD-X31732

Recombinant Human Granzyme B/GZMB Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Granzyme B/GZMB

  • 简介

    Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (227a.a, HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Granzyme B; CTLA-1; CCP1; Fragmentin-2; Gzmb

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10144

  • Expression Region

    I21-Y247

  • AA Sequence

    IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    Predicted band size: 26.6 kDa; Observed band size: 32-42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Granzyme B (GZMB) is a serine protease that plays a crucial role in the immune system, primarily in mediating apoptosis in target cells. It is predominantly expressed by cytotoxic T lymphocytes and natural killer (NK) cells, where it is released alongside perforin to induce programmed cell death in infected or malignant cells. Research into GZMB has gained significant interest due to its potential implications in cancer therapy and autoimmune diseases. The ability of GZMB to cleave a variety of cellular substrates suggests its involvement in diverse biological processes beyond apoptosis, including inflammation and tissue remodeling. However, the therapeutic applications of GZMB have been hindered by difficulties in obtaining functional recombinant proteins for studies. Advances in recombinant DNA technology have facilitated the production of GZMB in various expression systems, allowing for a deeper exploration of its mechanisms of action, substrate specificity, and potential as a therapeutic agent. Recent studies utilizing recombinant GZMB have revealed insights into its role in immune regulation and identified GZMB as a biomarker for certain cancer types. Furthermore, understanding the structure-function relationship of GZMB through crystallography and mutational analysis opens new avenues for drug development, particularly in designing inhibitors that can modulate its activity. As researchers continue to unravel the complexities of GZMB, its full potential in clinical applications and as a target for innovative therapies remains an active area of investigation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US