Analytical Data
-
Gene name
DNase1L3
-
简介
DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Dnase1l3Deoxyribonuclease gamma; DNase gamma; EC 3.1.21.-; DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD
-
Species
Mouse
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O55070
-
Expression Region
L26-S310
-
AA Sequence
LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNase1L3, a member of the deoxyribonuclease I (DNase I) family, is an enzyme encoded by the DNASE1L3 gene, which plays a critical role in the degradation of extracellular DNA. This enzyme has garnered attention in recent years due to its potential implications in various biological processes, including the resolution of inflammation, the clearance of apoptotic and necrotic cells, and the maintenance of genomic stability. Research has shown that dysregulation of DNase1L3 is associated with several autoimmune diseases, highlighting its importance in immune response and homeostasis. The enzyme is particularly known for its ability to degrade DNA released from dying cells, thereby preventing unintended immune activation. The study of recombinant DNase1L3 protein has opened avenues for understanding its structure-function relationship and mechanisms of action in health and disease. By producing this protein in recombinant systems, researchers can investigate its enzymatic activity, assess its potential therapeutic applications, and explore its role in cellular processes. Additionally, the development of recombinant DNase1L3 can offer insights into its interactions with other proteins and nucleic acids, further elucidating its biological significance. Overall, the ongoing research on DNase1L3 not only enhances our understanding of its physiological roles but also paves the way for potential clinical applications, particularly in the treatment of conditions characterized by excessive extracellular DNA, such as certain autoimmune disorders and inflammatory diseases.











