Recombinant Rat IL-2Rg Protein (HEK293), C-6*His

IL-2Rg

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-2R beta (M1-A262) with a C-Terminal His tag, which is produced in HEK293 cells.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED 50 for this effect is 0.8594 µg/mL, corresponding to a specific activity is 1163.603 units/mg in the presence of 5 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2. Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.8594 µg/mL, corresponding to a specific activity is 1163.603 units/mg in the presence of 5 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2.

Cytokine receptor common subunit gamma; IL-2RG; p64; CD132

Rat

HEK293

C-6*His

Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

Q68FU6

S25-A262

SKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPSLFALEA

Partial

41-50 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.