Analytical Data
-
Gene name
SENP1 Catalytic Domain
-
简介
SENP1 Catalytic Domain Protein hydrolyzes SUMO propeptides (SUMO1, SUMO2, and SUMO3), maturing them. It also deconjugates SUMO1, SUMO2, and SUMO3 from target proteins, impacting their activities. Interacts with MTA1 and CCAR2, influencing SIRT1 interaction and transcriptional activities, showcasing its regulatory role in SUMOylation processes. SENP1 Catalytic Domain Protein, Human (His) is the recombinant human-derived SENP1 Catalytic Domain protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Sentrin-specific protease 1; SENP1; Sentrin/SUMO-specific protease SENP1; SUMO-Specific Peptidase 1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9P0U3-1
-
Expression Region
415-644aa
-
AA Sequence
DSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
-
Protein Length
Partial
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
SENP1 (sentrin-specific protease 1) is a crucial enzyme in the SUMO (Small Ubiquitin-like Modifier) signaling pathway, responsible for the processing and deconjugation of SUMO moieties from target proteins. This post-translational modification plays a vital role in regulating various cellular functions, including gene expression, DNA repair, and cellular stress responses. Abnormal SENP1 activity has been implicated in several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases, highlighting its potential as a therapeutic target. The study of SENP1's catalytic domain is essential for elucidating its structural and functional characteristics. By producing and characterizing recombinant SENP1 catalytic domain, researchers aim to gain insights into its enzymatic mechanisms and substrate specificity. Understanding these aspects can facilitate the development of SENP1 inhibitors or modulators as novel therapeutic agents. Additionally, the availability of the recombinant protein allows for biochemical assays and structural studies that can reveal how SENP1 interacts with SUMO and its substrates, further elucidating the regulatory networks in which it operates. This research not only advances our knowledge of SENP1 but also contributes to the broader understanding of SUMOylation and its implications in health and disease.
