Analytical Data
-
Gene name
IL-20R alpha
-
简介
IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26[3]. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Alternative Names
Interleukin-20 receptor subunit alpha; IL-20R-alpha; IL-20RA; CRF2-8; IL-20R1; ZcytoR7
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHF4-1
-
Expression Region
V30-K250
-
AA Sequence
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-20R alpha, a subunit of the interleukin-20 receptor complex, plays a crucial role in mediating the effects of various cytokines, particularly IL-20 and IL-24, which are involved in inflammatory responses and skin disorders such as psoriasis. The IL-20R alpha subunit is expressed predominantly in epithelial tissues, and its signaling pathways are implicated in keratinocyte proliferation and differentiation. Understanding the function and mechanism of IL-20R alpha is critical for developing targeted therapies for diseases characterized by abnormal inflammatory responses. The generation of recombinant IL-20R alpha protein allows researchers to study its structural properties, binding affinities, and downstream signaling pathways in a controlled environment. This research may provide insights into its role in immune modulation and assist in identifying novel therapeutic targets for treating inflammatory diseases. Given the increasing prevalence of chronic inflammatory conditions, investigating the biological functions of IL-20R alpha is of significant interest in the field of immunology and therapeutics, promising advancements in precision medicine for patients suffering from these debilitating conditions.











