Cat: IPD-X10535

Recombinant Human IL-22R alpha 1 Protein (HEK293), C-hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-22R alpha 1

  • 简介

    IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Human (HEK293, Fc) is expressed by HEK 293 cells and has a transmembrane region (H16-T228) with a Fc tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-22R-alpha-1; IL-22RA1; CRF2-9; IL22R; IL22R1; IL-TIF-R1; zcytoR11

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6P7

  • Expression Region

    H16-T228

  • AA Sequence

    HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    60-68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-22R alpha 1, a critical receptor component for interleukin-22 (IL-22), plays a significant role in mediating immune responses and tissue homeostasis. IL-22, produced primarily by T-helper 17 (Th17) cells, is known for its protective functions in epithelial tissues, where it promotes cell proliferation, enhances barrier function, and supports tissue repair. The interaction between IL-22 and its receptor, IL-22R alpha 1, is crucial in various physiological and pathological contexts, including infections, autoimmune diseases, and chronic inflammatory conditions. Research on IL-22R alpha 1 recombinant protein aims to better understand its structural properties and signaling mechanisms, which could provide insights into developing therapeutic strategies targeting IL-22 signaling pathways. By generating and characterizing IL-22R alpha 1 recombinant protein, scientists can explore its potential as a biomarker or therapeutic target in diseases linked to dysregulated IL-22 signaling. Furthermore, studying this receptor's role in orchestrating immune responses highlights its potential impact on therapeutic approaches for inflammatory diseases, making IL-22R alpha 1 a promising focus for further research and drug development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US