Cat: IPD-X24169

Recombinant Mouse Calreticulin/CALR Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Calreticulin/CALR

  • 简介

    The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    When Recombinant Mouse CALR is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is 6.189 ng/mL. When Recombinant Mouse CALR is immobilized at 2.5 µg/mL (100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is 6.189 ng/mL.

  • Alternative Names

    Calr; Calreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP

  • Species

    Mouse

  • Source

    P. pastoris

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14211

  • Expression Region

    D18-L416

  • AA Sequence

    DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    48.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Calreticulin (CALR) is a multifunctional protein primarily located in the endoplasmic reticulum, playing crucial roles in calcium homeostasis, chaperone activity, and immune response modulation. The significance of CALR has escalated in recent years due to its association with various diseases, particularly myeloproliferative neoplasms (MPNs). Mutations in the CALR gene are found in a subset of patients with these disorders, contributing to abnormal cell proliferation and survival. Consequently, recombinant CALR proteins have gained attention for their potential in elucidating CALR's biological functions and the pathogenic mechanisms underlying CALR-mutated MPNs. Researchers are investigating the structural and functional properties of recombinant CALR, assessing its role in tumorigenesis and immune evasion, while also exploring its prospect as a therapeutic target. Understanding the dynamics of CALR and its variants provides vital insights into novel treatment strategies for CALR-related diseases, ultimately aiming for improved patient outcomes in hematologic malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US