Analytical Data
-
Gene name
SMAD3
-
简介
The SMAD3 protein acts as a receptor-regulated SMAD (R-SMAD), transducing signals from TGF-β and activin type 1 receptor kinase. After being activated by antigen-presenting cells, SMAD3 binds to the TRE element in the gene promoter and forms a complex with SMAD4 to activate transcription. SMAD3 Protein, Human (Flag-His) is the recombinant human-derived SMAD3 protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.
- Application
-
Alternative Names
Mothers against decapentaplegic homolog 3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; JV15-2; SMAD family member 3; SMAD 3; Smad3; hSMAD3; SMAD3; MADH3
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;N-Flag
-
Purity
Greater than 90% as determined by reducing SDS-PAGE.
-
Uniprot
P84022-1
-
Expression Region
S2-S425
-
AA Sequence
SSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
50-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMAD3 is a critical intracellular signaling protein that plays a key role in the transformating growth factor-beta (TGF-β) signaling pathway, which is involved in various cellular processes including cell growth, differentiation, and apoptosis. Dysregulation of SMAD3 has been linked to a number of diseases, including fibrosis, cancer, and cardiovascular diseases. As a member of the SMAD family, SMAD3 transmits signals from TGF-β ligands to the nucleus, where it regulates gene expression by forming complexes with other transcription factors. The study of recombinant SMAD3 protein is essential for understanding its biochemical properties, interaction with other proteins, and its functional role in TGF-β signaling. Researchers often use recombinant SMAD3 to investigate its structure-function relationships and to screen for potential therapeutic targets, particularly in contexts where TGF-β signaling is aberrant. Furthermore, characterization of SMAD3 at the molecular level can provide insights into its mechanisms of action and offer potential avenues for therapeutic intervention in diseases linked to TGF-β signaling dysregulation. Overall, the exploration of SMAD3 as a recombinant protein not only enhances our understanding of its biological functions but also holds promise for developing novel strategies for treating TGF-β-related diseases.
