Analytical Data
-
Gene name
BPHL
-
简介
The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (P.pastoris, His-Myc) is the recombinant human-derived BPHL protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.
- Application
-
Alternative Names
Biphenyl hydrolase like; Biphenyl hydrolase related; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; Bphrp; VACVase; Valacyclovir hydrolase; Valacyclovirase
-
Species
Human
-
Source
P. pastoris
-
Tag
N-His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WA6
-
Expression Region
S38-Q291
-
AA Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BPHL (Butyrylcholinesterase-Like Protein) is a member of the serine hydrolase family, which plays a crucial role in various physiological processes, including lipid metabolism and neurotransmission. Its research background is rooted in the increasing interest in enzyme functions and their implications in health and disease. Studies have shown that BPHL may be involved in the hydrolysis of bioactive compounds and could influence drug metabolism and clearance in the body. Given its lack of thorough characterization compared to other members of its family, there is a growing impetus to explore its potential as a biomarker for certain diseases and as a target in drug design and therapeutic applications. Moreover, BPHL's role in regulating cholinergic and neuroprotective functions highlights its potential relevance in neurodegenerative disorders, such as Alzheimer's disease. Investigating BPHL's structure, function, and interaction with various substrates may provide deeper insights into its biological roles and pave the way for novel therapeutic strategies in treating diseases linked to cholinergic dysfunction and metabolic disorders. As recombinant protein technology advances, producing BPHL in a laboratory setting promises to facilitate these studies, allowing for a comprehensive analysis of its enzymatic properties, structure-function relationships, and potential clinical applications. Thus, BPHL represents a promising frontier in enzymology and biomedical research, with implications that extend across multiple areas of health science.











