Cat: IPD-X32177

Recombinant Human BPHL Protein (P. pastoris),His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BPHL

  • 简介

    The BPHL protein is a serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs, such as nucleoside analogs such as valacyclovir and valganciclovir. It converts valacyclovir to acyclovir via hydrolysis. BPHL Protein, Human (P.pastoris, His-Myc) is the recombinant human-derived BPHL protein, expressed by P. pastoris , with N-His, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Biphenyl hydrolase like; Biphenyl hydrolase related; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; Bphrp; VACVase; Valacyclovir hydrolase; Valacyclovirase

  • Species

    Human

  • Source

    P. pastoris

  • Tag

    N-His;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86WA6

  • Expression Region

    S38-Q291

  • AA Sequence

    SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BPHL (Butyrylcholinesterase-Like Protein) is a member of the serine hydrolase family, which plays a crucial role in various physiological processes, including lipid metabolism and neurotransmission. Its research background is rooted in the increasing interest in enzyme functions and their implications in health and disease. Studies have shown that BPHL may be involved in the hydrolysis of bioactive compounds and could influence drug metabolism and clearance in the body. Given its lack of thorough characterization compared to other members of its family, there is a growing impetus to explore its potential as a biomarker for certain diseases and as a target in drug design and therapeutic applications. Moreover, BPHL's role in regulating cholinergic and neuroprotective functions highlights its potential relevance in neurodegenerative disorders, such as Alzheimer's disease. Investigating BPHL's structure, function, and interaction with various substrates may provide deeper insights into its biological roles and pave the way for novel therapeutic strategies in treating diseases linked to cholinergic dysfunction and metabolic disorders. As recombinant protein technology advances, producing BPHL in a laboratory setting promises to facilitate these studies, allowing for a comprehensive analysis of its enzymatic properties, structure-function relationships, and potential clinical applications. Thus, BPHL represents a promising frontier in enzymology and biomedical research, with implications that extend across multiple areas of health science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US