Analytical Data
-
Gene name
HAS2
-
简介
The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
-
Species
Mouse
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P70312
-
Expression Region
E67-L374
-
AA Sequence
EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
-
Protein Length
Partial
-
Molecular Weight
36-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Hyaluronan synthase 2 (HAS2) is a crucial enzyme responsible for synthesizing hyaluronan, a glycosaminoglycan that plays vital roles in various physiological processes, including tissue hydration, cell proliferation, and wound healing. Aberrations in HAS2 activity have been linked to numerous pathological conditions, such as cancer, arthritis, and cardiovascular diseases, making it a significant target for therapeutic interventions. Researchers have been keen to characterize HAS2 through recombinant protein technology, which allows for the production of large quantities of the enzyme in a controlled environment. This approach facilitates detailed studies of HAS2's biochemical properties, enzymatic mechanisms, and interactions with other cellular components. Additionally, recombinant HAS2 provides a valuable tool for investigating the role of hyaluronan in cell signaling and its potential as a biomarker for disease progression. Understanding the behavior and regulation of HAS2 not only contributes to basic science but also paves the way for the development of novel treatments aimed at modulating hyaluronan levels in various diseases. Overall, the study of recombinant HAS2 is a promising avenue in biomedical research, offering insights into hyaluronan's diverse functionalities and its implications in health and disease.











