Cat: IPD-X36952

Recombinant Mouse HAS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HAS2

  • 简介

    The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P70312

  • Expression Region

    E67-L374

  • AA Sequence

    EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

  • Protein Length

    Partial

  • Molecular Weight

    36-38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Hyaluronan synthase 2 (HAS2) is a crucial enzyme responsible for synthesizing hyaluronan, a glycosaminoglycan that plays vital roles in various physiological processes, including tissue hydration, cell proliferation, and wound healing. Aberrations in HAS2 activity have been linked to numerous pathological conditions, such as cancer, arthritis, and cardiovascular diseases, making it a significant target for therapeutic interventions. Researchers have been keen to characterize HAS2 through recombinant protein technology, which allows for the production of large quantities of the enzyme in a controlled environment. This approach facilitates detailed studies of HAS2's biochemical properties, enzymatic mechanisms, and interactions with other cellular components. Additionally, recombinant HAS2 provides a valuable tool for investigating the role of hyaluronan in cell signaling and its potential as a biomarker for disease progression. Understanding the behavior and regulation of HAS2 not only contributes to basic science but also paves the way for the development of novel treatments aimed at modulating hyaluronan levels in various diseases. Overall, the study of recombinant HAS2 is a promising avenue in biomedical research, offering insights into hyaluronan's diverse functionalities and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US