Analytical Data
-
Gene name
IL2Ra
-
简介
IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2].IL-2R alpha/CD25 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells.
- Application
-
Biological Activity
Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.5-1.5 μg/mL in the presence of 30 ng/mL of recombinant human IL-2. Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.8305 μg/mL in the presence of 30 ng/mL of recombinant human IL-2, corresponding to a specific activity is 1.2×103 units/mg.
-
Alternative Names
Interleukin-2 receptor subunit alpha; IL-2-RA; CD25; TCGFR; p55
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
P01590
-
Expression Region
Glu22~Lys236
-
AA Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK
-
Protein Length
Extracellular Domain
-
Molecular Weight
40-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL2Ra, also known as the interleukin-2 receptor alpha chain, plays a crucial role in the immune system by modulating the activity of interleukin-2 (IL-2), a key cytokine involved in T-cell proliferation and differentiation. The IL2Ra receptor is primarily expressed on activated T cells, and its function is pivotal in maintaining immune homeostasis and tolerance. Dysregulation or overexpression of IL2Ra has been implicated in various autoimmune diseases, cancers, and immunodeficiencies. Given its central role in immune responses, IL2Ra has emerged as a target for therapeutic interventions. Researchers have focused on the development of recombinant IL2Ra proteins for several purposes, including enhancing our understanding of immune regulation, designing novel immunotherapies, and as potential biomarkers for disease progression. Advances in recombinant DNA technology have facilitated the production of high-purity IL2Ra proteins, allowing for in-depth studies of their structure and function. These efforts aim to elucidate the underlying mechanisms of IL2Ra signaling pathways and discover new strategies to modulate immune responses in pathological conditions. As a result, the research surrounding IL2Ra recombinant proteins is rapidly evolving, providing insights that could lead to innovative approaches in treating immune-related disorders.








