Analytical Data
-
Gene name
CHST15
-
简介
The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc(4,6-SO(4)) units. It also sulfates the unique non-reducing terminal sequence GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.
- Application
-
Alternative Names
Carbohydrate sulfotransferase 15; hBRAG; GalNAc4S-6ST; BRAG
-
Species
Human
-
Source
HEK293
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7LFX5-1
-
Expression Region
S99-T561
-
AA Sequence
SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT
-
Protein Length
Partial
-
Molecular Weight
70-90 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHST15, or Carbohydrate Sulfotransferase 15, is an essential enzyme involved in the sulfation of carbohydrate moieties, particularly in the biosynthesis of glycosaminoglycans (GAGs) such as heparan sulfate and chondroitin sulfate. These GAGs play crucial roles in various biological processes, including cell signaling, development, and tissue repair. Abnormalities in the sulfation patterns of GAGs due to CHST15 deficiencies have been linked to several pathophysiological conditions, including cardiovascular diseases, cancer, and developmental disorders. As a result, understanding the structure and function of recombinant CHST15 protein is vital for elucidating its role in these processes. Moreover, the production of recombinant CHST15 offers a powerful tool for biochemical studies, enabling researchers to investigate its activity, substrate specificity, and interactions with other proteins. This research can lead to advances in therapeutic strategies targeting GAG-related diseases, as well as the development of novel biomaterials for regenerative medicine. Additionally, understanding the regulation of CHST15 and its impact on GAG sulfation may provide insights into potential biomarkers for disease diagnosis and prognosis. Thus, the study of recombinant CHST15 not only enhances our knowledge of fundamental biological mechanisms but also has significant implications for translational research in medicine.
