Analytical Data
-
Gene name
MMP-2
-
简介
MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.
- Application
-
Biological Activity
1. Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 ((HY-131498) and the specific activity is > 1,000 pmoles/min/µg. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.) 2. Measured by its binding ability in a functional ELISA. Immobilized Human MMP-2 at 2 μg/mL (100 μl/well) can bind Human TIMP2 hFc and the EC50 is 6.0-30.0 ng/mL. Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 11011 pmol/min/µg, as measured under the described conditions.
-
Alternative Names
72 kDa Type IV Collagenase; Gelatinase A; MMP-2; TBE-1; CLG4A
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P08253-1
-
Expression Region
A30-C660
-
AA Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Matrix metalloproteinase-2 (MMP-2), also known as gelatinase A, is a member of the matrix metalloproteinase family and plays a crucial role in the degradation of extracellular matrix components, particularly type IV and type V collagen. It is involved in various physiological and pathological processes, including embryogenesis, wound healing, tissue remodeling, and cancer metastasis. The overexpression and activation of MMP-2 have been linked to the progression of several diseases, including cancer, cardiovascular diseases, and neurodegenerative disorders, making it a significant target for therapeutic intervention. Given its relevance in disease mechanisms, the production of recombinant MMP-2 proteins has become a focus of research. This allows for detailed studies of its enzymatic activity, regulation, and interactions with various inhibitors. Recombinant MMP-2 can be utilized as a model to investigate its role in disease or to develop novel pharmacological agents that can inhibit its activity, providing valuable insights into potential clinical applications. The advancement of biotechnological methods has significantly improved the efficiency and yield of producing functional recombinant MMP-2, enabling extensive research paths that explore its structure-function relationship, regulatory mechanisms, and potential as a biomarker for various diseases. This ongoing research underscores the importance of MMP-2 not only in fundamental biology but also in the development of new therapeutic strategies aimed at mitigating its contribution to disease pathology.











