Cat: IPD-X29227

Recombinant Mouse HCFC2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HCFC2

  • 简介

    HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Host cell factor 2 ; HCF-2; C2 factor; Hcfc2

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    G5E837

  • Expression Region

    M1-E486

  • AA Sequence

    MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE

  • Protein Length

    Partial

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HCFC2, or Hydrochlorofluorocarbon 2, is a significant subject of research due to its implications in environmental science and industrial applications. As a member of the HCFCs family, HCFC2 was initially developed to replace ozone-depleting substances like chlorofluorocarbons (CFCs) in refrigeration and air conditioning systems. However, while HCFCs were seen as a transitional solution, they still pose environmental concerns, particularly regarding their greenhouse gas potential and contribution to ozone layer depletion. In recent years, the focus has shifted toward understanding the biochemistry of HCFC2, including its synthesis, degradation, and interaction with various biological systems. Researchers are particularly interested in the development of recombinant proteins to study the mechanisms of HCFC2 degradation by specific microbial strains, which can offer insights into bioremediation strategies. These studies aim not only to mitigate the environmental impact of HCFCs but also to explore sustainable alternatives that have lower environmental risks. Through genetic engineering and protein expression techniques, scientists are developing novel methods to enhance the degradation pathways for HCFC2, with the hope of finding effective solutions to reduce the accumulation of these compounds in the atmosphere.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US