Analytical Data
-
Gene name
Collagen alpha-1(XVIII) chain/COL18A1
-
简介
The COL18A1 protein may play a key role in shaping retinal structure and promoting neural tube closure. Its involvement extends to the regulation of extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells. Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1(XVIII) chain/COL18A1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rMuCollagen Alpha-1(XVIII) Chain/Endostatin, His; antiangiogenic agent; COL18A1; collagen alpha-1(XVIII)chain; collagen; type XVIII; Endostatin
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39061
-
Expression Region
H1591-K1774
-
AA Sequence
HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK
-
Protein Length
Partial
-
Molecular Weight
18.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Collagen alpha-1(XVIII) chain, also known as COL18A1, is a crucial component of the extracellular matrix, playing significant roles in tissue development, integrity, and repair. This protein is primarily associated with basement membranes and is involved in various physiological processes, including angiogenesis, tissue remodeling, and cell signaling. Mutations or dysregulation of COL18A1 have been linked to several medical conditions, including congenital disorders such as Knobloch syndrome and eye-related pathologies. Due to its multifaceted roles in development and disease, COL18A1 has garnered substantial interest in biomedical research. Recombinant COL18A1 protein production allows for detailed studies of its structure-function relationships, interactions with other matrix components, and potential therapeutic applications, such as regenerative medicine and targeted drug delivery systems. Additionally, understanding the mechanisms underlying COL18A1 expression and function could yield new insights into strategies for treatment of diseases associated with collagen deficiencies, making this protein a vital focus of ongoing research efforts.











