Analytical Data
-
Gene name
MOB4
-
简介
The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.
- Application
-
Alternative Names
MOB-Like Protein Phocein; 2C4D; Class II mMOB1; Mob1 Homolog 3; Mob3; Mps One Binder Kinase Activator-Like 3; Preimplantation Protein 3; MOB4; MOB3; MOBKL3; PHOCN; PREI3
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3A3
-
Expression Region
M1-A225
-
AA Sequence
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
-
Protein Length
Full Length
-
Molecular Weight
29.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOB4 (MOB kinase activator 4) is a protein that plays a crucial role in several cellular processes, including cell signaling, proliferation, and differentiation. As a member of the MOB family, it functions as a co-activator of NDR (nuclear Dbf2-related) kinase, which is essential for the regulation of cell cycle and development in various organisms. However, the exact mechanisms underlying MOB4's functions and its potential roles in disease pathways remain largely unexplored. Recent studies have highlighted the importance of understanding MOB4 interactions within the context of cellular signaling networks, particularly in relation to cancer and developmental disorders. Scientists are increasingly focusing on the recombinant expression and purification of MOB4 to investigate its structural and functional properties in detail. This recombinant protein research aims to elucidate the biochemical pathways influenced by MOB4, paving the way for potential therapeutic targets. Understanding the functional dynamics of MOB4 could provide critical insights into its role in human health and disease, making it a significant subject of ongoing research in molecular biology and biochemistry.
