Analytical Data
-
Gene name
EXTL2
-
简介
The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.
- Application
-
Alternative Names
Exostosin-like 2; Extl2; Alpha-1; 4-N-acetylhexosaminyltransferase EXTL2; Alpha-GalNAcT EXTL2; EXT-related protein 2; Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
-
Species
Mouse
-
Source
HEK293
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ES89
-
Expression Region
N43-M330
-
AA Sequence
NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
-
Protein Length
Lumenal Domain
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXTL2 is a member of the extasin family, playing a vital role in the biosynthesis of heparan sulfate, a type of glycosaminoglycan that is essential for various biological processes, including cell signaling, growth factor binding, and cell-matrix interactions. The significance of EXTL2 is underscored by its involvement in developmental processes and its implications in disease, particularly in cancers and congenital disorders. Studies have shown that mutations in the EXTL2 gene can lead to alterations in heparan sulfate structure and function, which may contribute to tumor progression and metastasis due to disrupted cellular communication. As research continues, recombinant EXTL2 protein has garnered attention for its potential applications in understanding the mechanisms by which heparan sulfate influences cellular behavior and disease pathogenesis. By producing and characterizing EXTL2 recombinant protein, scientists aim to elucidate its functional properties and interactions within the extracellular matrix, offering insights into therapeutic targets for conditions related to aberrant heparan sulfate metabolism. This research not only promises to deepen our understanding of glycosaminoglycan biology but also holds potential implications for developing novel strategies in regenerative medicine and oncology, where heparan sulfate's role in tumor microenvironments is pivotal. Thus, EXTL2 serves as a crucial point of study in both fundamental biology and translational medicine, highlighting its relevance in health and disease contexts.
