Analytical Data
-
Gene name
SULT1A2
-
简介
Sulfotransferase 1A2 (SULT1A2) is a phenol sulfotransferase with thermostable enzyme activity. SULT1A2 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A2 is also responsible for the sulfonation and activation of minoxidil. SULT1A2 induces the mutagenicity and carcinogenicity of certain substrates by influencing DNA adduct formation. SULT1A2 Protein, Human (His) is the recombinant human-derived SULT1A2 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Sulfotransferase 1A2; ST1A2; Aryl Sulfotransferase 2; Phenol Sulfotransferase 2; Phenol-Sulfating Phenol Sulfotransferase 2; P-PST 2; SULT1A2; STP2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAI13728.1
-
Expression Region
M1-L295
-
AA Sequence
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
-
Protein Length
Full Length
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1A2, or Sulfotransferase 1A2, is an important enzyme that catalyzes the sulfonation of various endogenous and exogenous compounds, playing a critical role in drug metabolism and detoxification processes. This enzyme is part of the sulfotransferase family, which is involved in the phase II metabolic reactions that modify small molecules, including hormones, neurotransmitters, and drugs, to enhance their solubility and excretion. Recent studies have highlighted the individual variability in SULT1A2 activity due to genetic polymorphisms, leading to differences in drug responses and susceptibility to toxins. Furthermore, SULT1A2 has been implicated in the metabolism of environmental contaminants and pharmaceuticals, making it a significant focus of pharmacogenomics and toxicology research. Understanding the structure and function of SULT1A2 through the study of its recombinant protein is essential for elucidating its role in biotransformation pathways and its potential implications in personalized medicine. Advances in recombinant DNA technology have enabled the production of SULT1A2 protein in vitro, allowing researchers to investigate its enzymatic properties, substrate specificity, and interaction with various inhibitors. These insights not only contribute to a fundamental understanding of the enzyme's biochemistry but also hold promise for developing therapeutic strategies and improving drug safety profiles in clinical settings.
