Analytical Data
-
Gene name
SPEB
-
简介
The SPEB protein plays a central role in cellular processes as it catalyzes the formation of putrescine from agmatine. This enzyme activity is essential for the biosynthesis of putrescine, a polyamine with important functions in cell growth, proliferation, and various physiological processes. SPEB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived SPEB protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Application
-
Alternative Names
speB; EC55989_3229; Agmatinase; EC 3.5.3.11; Agmatine ureohydrolase; AUH
-
Species
E.coli
-
Source
E. coli
-
Tag
N-6*His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B7LFJ6
-
Expression Region
M1-E306
-
AA Sequence
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE
-
Protein Length
Full Length
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPEB (Streptococcus pneumoniae Exported Protein B) is a protein of significant interest in the study of bacterial pathogenesis and immune response, particularly within the context of Streptococcus pneumoniae, a major human pathogen responsible for diseases such as pneumonia, meningitis, and otitis media. Recent research has highlighted the role of SPEB in the bacterial life cycle and its potential as a factor in immune evasion. Understanding the structural and functional characteristics of SPEB can illuminate mechanisms by which S. pneumoniae survives and propagates in host environments. The protein is believed to interact with host immune components, possibly modulating the host's immune response and enhancing bacterial virulence. Investigating the SPEB protein may offer insights into its role in biofilm formation and adherence to host tissues, which are critical aspects of bacterial colonization. Moreover, this research carries implications for vaccine development and novel therapeutic strategies aimed at combating pneumococcal infections. By elucidating the biological functions and structure of SPEB, scientists hope to identify potential targets for intervention that could reduce the burden of diseases caused by this pathogen, improving public health outcomes. The study of SPEB is thus situated at the nexus of microbiology, immunology, and therapeutics, highlighting its importance in understanding both pathogen biology and host-pathogen interactions in the quest for more effective treatment options.











