Cat: IPD-X24983

Recombinant Human Collagen alpha-1(VIII) chain/COL8A1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Collagen alpha-1(VIII) chain/COL8A1

  • 简介

    Collagen alpha-1(VIII) chain (COL8A1) is an important macromolecular component of Descemet membrane formation and the endothelial lining of blood vessels. COL8A1 is critical for vascular smooth muscle cell migration and proliferation, suggesting its importance in maintaining the structural integrity of the vessel wall, particularly in atherogenesis. Collagen alpha-1 (VIII) chain/COL8A1 Protein, Human (HEK293, His) is the recombinant human-derived Collagen alpha-1(VIII) chain/COL8A1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCollagen alpha-1(VIII) chain/COL8A1, His ; Collagen Alpha-1(VIII) Chain; Endothelial Collagen; Vastatin; COL8A1; C3orf7

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P27658

  • Expression Region

    G28-M744

  • AA Sequence

    GAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPHMPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGEIGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPKGDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGPIGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKGDRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    54.55&78.13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The collagen alpha-1(VIII) chain, also known as COL8A1, is a crucial component of the extracellular matrix, particularly in the structure of various tissues, including the vascular system and the cornea. Its primary role involves providing structural support and maintaining the integrity of these tissues. Abnormalities in COL8A1 have been linked to various pathologies, such as glaucoma and corneal dystrophies, highlighting its significance in ocular health and disease. The study of COL8A1 is vital for understanding tissue development, repair mechanisms, and the underlying causes of related disorders. Recombinant COL8A1 protein production allows for in-depth investigation of its functional properties, interactions, and potential therapeutic applications. By utilizing advanced molecular biology techniques, researchers aim to elucidate the structural and biological characteristics of this collagen type, ultimately paving the way for novel treatments targeting COL8A1-related diseases. Furthermore, understanding the mechanisms behind COL8A1 function may contribute to advancements in tissue engineering and regenerative medicine, enhancing therapeutic strategies for conditions involving collagen deficiencies. Overall, the exploration of COL8A1 is not only critical for scientific understanding but also holds promise for clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US