Analytical Data
-
Gene name
SMN1
- Application
-
Alternative Names
Survival Motor Neuron 1,SMN1
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16637-1
-
Expression Region
A2-N294
-
AA Sequence
AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
36-40 kDa & 69 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SMN1 (Survival Motor Neuron 1) recombinant protein is primarily motivated by its crucial role in spinal muscular atrophy (SMA), a genetic disorder characterized by the degeneration of motor neurons in the spinal cord, leading to progressive muscle weakness and atrophy. SMN1 is essential for the survival and maintenance of motor neurons, and its loss or mutation results in insufficient levels of SMN protein, which is vital for several cellular processes, including RNA metabolism and transport. Understanding the structure and function of recombinant SMN1 protein is critical for elucidating the molecular mechanisms underlying SMA and developing effective therapeutic strategies. Recent advancements in recombinant DNA technology have facilitated the production of SMN1 protein in various biological systems, enabling researchers to study its biophysical properties, interaction with other cellular proteins, and the effects of SMN deficiency at a molecular level. This research is essential not only for accelerating the discovery of new SMA treatments but also for providing insights into related neuromuscular disorders. By generating and characterizing SMN1 recombinant protein, researchers aim to explore potential gene therapy approaches, small molecules, or other biological agents that can restore SMN function and improve motor neuron health. As such, the investigation of SMN1 recombinant protein stands at the forefront of neurogenetics and therapeutic development, with the potential to transform the lives of individuals affected by SMA.











