Analytical Data
-
Gene name
MICA
-
简介
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, Fc) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH16929.1
-
Expression Region
E24-Q308
-
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
-
Protein Length
Partial
-
Molecular Weight
85-110 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MICA, or MHC class I chain-related protein A, is a crucial member of the MHC class I family that plays a significant role in the immune response, particularly in the activation of Natural Killer (NK) cells. Its expression is often upregulated in response to cellular stress, infection, or transformation, marking affected cells for recognition and elimination by the immune system. Research into MICA recombinant proteins has gained momentum due to their potential applications in cancer immunotherapy and transplantation. Understanding the molecular mechanisms governing MICA interactions with NK cell receptors, such as NKG2D, is essential for developing therapeutic strategies that enhance anti-tumor immunity. Furthermore, MICA's polymorphic nature and differential expression patterns in various tissues can impact its effectiveness as a therapeutic target. Studies focusing on the production and characterization of recombinant MICA proteins help elucidate their structural and functional properties, enabling researchers to explore novel ways to modulate immune responses for treating diseases. These investigations not only advance our comprehension of the immune system's complexities but also hold promise for innovative approaches in clinical settings aimed at improving patient outcomes.











