Analytical Data
-
Gene name
IL-22R alpha 1
-
简介
IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Canine (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (M1-The226) with a His tag at the C-terminus[1].
- Application
-
Biological Activity
Immobilized Human IL-22 at 5 μg/mL (100 μL/well) can bind Canine IL-22 R alpha 1. The ED50 for this effect is 158.1 ng/mL. Immobilized Human IL-22 at 5 μg/mL (100 μL/well) can bind Canine IL-22 R alpha 1. The ED50 for this effect is 158.1 ng/mL
-
Alternative Names
Interleukin-22 receptor subunit alpha-1; IL-22R-alpha-1; IL-22RA1; CRF2-9; ZcytoR11; IL22R
-
Species
Canine
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
XP_855113.2
-
Expression Region
A15-T226
-
AA Sequence
AHIAEDTSDLLQYVKFQSSNFENILTWDSGLESAPDVVYSVEYKTYGKKEWLAKEGCQRITRKSCNLTTETGNHTEHYYARVTAVSAGGRSATKMTDRFSSMQQTTIKPPDVTCIPKVRSIQMIVHPTSTPIHAEDGHRLTLEDIFQDLFYRLELQVNHTYQMHLGGKQRDYEFIGLSPDTEFLGTITISVPNFFKESAPYVCRVKTLPDRT
-
Protein Length
Partial
-
Molecular Weight
28-37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-22R alpha 1, a critical receptor component for interleukin-22 (IL-22), plays a significant role in mediating immune responses and tissue homeostasis. IL-22, produced primarily by T-helper 17 (Th17) cells, is known for its protective functions in epithelial tissues, where it promotes cell proliferation, enhances barrier function, and supports tissue repair. The interaction between IL-22 and its receptor, IL-22R alpha 1, is crucial in various physiological and pathological contexts, including infections, autoimmune diseases, and chronic inflammatory conditions. Research on IL-22R alpha 1 recombinant protein aims to better understand its structural properties and signaling mechanisms, which could provide insights into developing therapeutic strategies targeting IL-22 signaling pathways. By generating and characterizing IL-22R alpha 1 recombinant protein, scientists can explore its potential as a biomarker or therapeutic target in diseases linked to dysregulated IL-22 signaling. Furthermore, studying this receptor's role in orchestrating immune responses highlights its potential impact on therapeutic approaches for inflammatory diseases, making IL-22R alpha 1 a promising focus for further research and drug development.
