Analytical Data
-
Gene name
TMCO1
- Application
-
Species
Human
-
Source
E. coli Cell-free
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UM00
-
Expression Region
M1-S188
-
AA Sequence
STMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
-
Protein Length
Partial
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMCO1, or Transmembrane and Coiled-Coil Domain 1, is a protein that has garnered attention in recent years due to its role in various cellular processes, including calcium homeostasis and cell proliferation. Initial studies have indicated that TMCO1 may function as an essential component of the endoplasmic reticulum (ER) and is involved in the regulation of Ca2+ levels within cells. Dysregulation of calcium signaling has been implicated in numerous diseases, including neurodegenerative disorders and cancer, highlighting the importance of understanding TMCO1's biological functions. Research has shown that TMCO1 is not only crucial for maintaining ER function but also plays a role in modulating stress responses within cells. Its potential involvement in pathophysiological conditions has spurred efforts to investigate the structural characteristics and functional mechanisms of TMCO1 through recombinant protein techniques. By expressing TMCO1 as a recombinant protein, scientists aim to characterize its biochemical properties, explore its interactions with other cellular components, and elucidate its precise role in disease mechanisms. This research could ultimately contribute to identifying TMCO1 as a potential therapeutic target, emphasizing its significance in both basic biology and clinical applications.
